PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6NG327900.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 135aa    MW: 15375.7 Da    PI: 10.3984
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6NG327900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.85.8e-283988251
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         rie+ + rqv fskRr g++KKA+ELSvLCda+va+i+fs+ g+lye++s
  Pavir.6NG327900.2.p 39 RIEDRTSRQVRFSKRRSGLFKKAYELSVLCDAQVALIVFSPAGRLYEFAS 88
                         8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.3053090IPR002100Transcription factor, MADS-box
SMARTSM004326.8E-353089IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-293252IPR002100Transcription factor, MADS-box
CDDcd002653.30E-343294No hitNo description
SuperFamilySSF554557.19E-2832102IPR002100Transcription factor, MADS-box
PfamPF003195.3E-273986IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-295267IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-296788IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MEEREEATTA RRAELQLLQQ LDKEEIKGKR KRGRVELRRI EDRTSRQVRF SKRRSGLFKK  60
AYELSVLCDA QVALIVFSPA GRLYEFASSG SRGMEANAEE MSMTEIRNLE ETVTDALAAI  120
RNKLRMKVVG LPQT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-183289360Myocyte-specific enhancer factor 2B
1tqe_R2e-183289360Myocyte-specific enhancer factor 2B
1tqe_Q2e-183289360Myocyte-specific enhancer factor 2B
1tqe_P2e-183289360Myocyte-specific enhancer factor 2B
1n6j_B3e-183289259Myocyte-specific enhancer factor 2B
1n6j_A3e-183289259Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.180531e-34leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0055292e-66AP005529.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0702E04.
GenBankAP0149642e-66AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974004.11e-53PREDICTED: MADS-box transcription factor 56-like
RefseqXP_012702155.11e-53PREDICTED: MADS-box transcription factor 56-like
TrEMBLK3YJX11e-46K3YJX1_SETIT; Uncharacterized protein
STRINGSi014540m3e-46(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.11e-25AGAMOUS-like 14